Lineage for d5de9a1 (5de9 A:5-404)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005512Species Streptomyces coelicolor [TaxId:100226] [187338] (8 PDB entries)
  8. 2005518Domain d5de9a1: 5de9 A:5-404 [277516]
    Other proteins in same PDB: d5de9a2, d5de9b2
    automated match to d2d0ea_
    complexed with hem, spm

Details for d5de9a1

PDB Entry: 5de9 (more details), 1.76 Å

PDB Description: the role of ile87 of cyp158a2 in oxidative coupling reaction
PDB Compounds: (A:) Biflaviolin synthase CYP158A2

SCOPe Domain Sequences for d5de9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5de9a1 a.104.1.1 (A:5-404) automated matches {Streptomyces coelicolor [TaxId: 100226]}
tisqavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddvrlvt
ndprfgreavmdrqvtrlaphfrpargavgfldppdhtrlrrsvaaaftargvervrers
rgmldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlilssshg
aevseraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllqigge
avtnnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialedveik
gvriragdavyvsylaanrdpevfpdpdridferspnphvsfgfgphycpggmlarlese
llvdavldrvpglklavapedvpfkkgalirgpealpvtw

SCOPe Domain Coordinates for d5de9a1:

Click to download the PDB-style file with coordinates for d5de9a1.
(The format of our PDB-style files is described here.)

Timeline for d5de9a1:

  • d5de9a1 first appeared in SCOPe 2.05, called d5de9a_

View in 3D
Domains from same chain:
(mouse over for more information)
d5de9a2