SCOPe 2.06: Domain d5cxoa1: 5cxo A:1-128

Lineage for d5cxoa1 (5cxo A:1-128)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (26 species)
   not a true protein

7. Species Streptomyces albus [TaxId:1888] [277508] (1 PDB entry)

8. Domain d5cxoa1: 5cxo A:1-128 [277509]
   Other proteins in same PDB: d5cxoa2, d5cxob2
   automated match to d1ocva_
   complexed with p6g

Details for d5cxoa1

PDB Entry: 5cxo, 1.8 Å

PDB Description: intriguing role of epoxide hydrolase/cyclase-like enzyme salbiii in pyran ring formation in polyether salinomycin

PDB Compounds: (A:) epoxide hydrolase

SCOPe Domain Sequences for d5cxoa1:

Sequence; same for both SEQRES and ATOM records:

>d5cxoa1 d.17.4.0 (A:1-128) automated matches {Streptomyces albus [TaxId: 1888]}
mqdeqkrkeivaeyfrkvnegdvdaivemftenatiedpvgkdvregraaqreyfnsnvt
aevtiepghlsagqdgksvavalaaemtnildpnrtrvkinavdvftltpegkidsmrvf
wgmtdigv

Timeline for d5cxoa1:

• d5cxoa1 first appeared in SCOPe 2.05, called d5cxoa_
  
• d5cxoa1 appears in SCOPe 2.07
  
• d5cxoa1 appears in the current release, SCOPe 2.08