Lineage for d5c8cc_ (5c8c C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431063Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2431354Protein automated matches [190854] (25 species)
    not a true protein
  7. 2431364Species Coxsackievirus a16 (strain tainan/5079/98) [TaxId:231417] [277504] (1 PDB entry)
  8. 2431365Domain d5c8cc_: 5c8c C: [277505]
    Other proteins in same PDB: d5c8ca_
    automated match to d5c4wc_
    complexed with cl, k, ste

Details for d5c8cc_

PDB Entry: 5c8c (more details), 2.5 Å

PDB Description: crystal structure of recombinant coxsackievirus a16 capsid
PDB Compounds: (C:) vp3

SCOPe Domain Sequences for d5c8cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c8cc_ b.121.4.1 (C:) automated matches {Coxsackievirus a16 (strain tainan/5079/98) [TaxId: 231417]}
giptelkpgtnqflttddgvsapilpgfhptppihipgevhnlleicrvetilevnnlkt
nettpmqrlcfpvsvqsktgelcaafradpgrdgpwqstilgqlcryytqwsgslevtfm
fagsfmatgkmliaytppggnvpadritamlgthviwdfglqssvtlvvpwisnthyrah
aragyfdyyttgiitiwyqtnyvvpigapttayivalaaaqdnftmklckdtedieqtan
iq

SCOPe Domain Coordinates for d5c8cc_:

Click to download the PDB-style file with coordinates for d5c8cc_.
(The format of our PDB-style files is described here.)

Timeline for d5c8cc_: