Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (22 species) not a true protein |
Species Coxsackievirus a16 (strain tainan/5079/98) [TaxId:231417] [277502] (1 PDB entry) |
Domain d5c8ca_: 5c8c A: [277503] Other proteins in same PDB: d5c8cc_ automated match to d4ceya_ complexed with cl, k, ste |
PDB Entry: 5c8c (more details), 2.5 Å
SCOPe Domain Sequences for d5c8ca_:
Sequence, based on SEQRES records: (download)
>d5c8ca_ b.121.4.0 (A:) automated matches {Coxsackievirus a16 (strain tainan/5079/98) [TaxId: 231417]} gdpiadmidqtvnnqvnrsltalqvlptaanteasshrlgtgvvpalqaaetgassnasd knlietrcvlnhhstqetaignffsraglvsiitmpttgtqntdgyvnwdidlmgyaqlr rkcelftymrfdaeftfvvakpngelvpqllqymyvppgapkptsrdsfawqtatnpsvf vkmtdppaqvsvpfmspasayqwfydgyptfgehlqandldygqcpnnmmgtfsirtvgt eksphsitlrvymrikhvrawiprplrnqpylfktnpnykgndikctstsrdkittl
>d5c8ca_ b.121.4.0 (A:) automated matches {Coxsackievirus a16 (strain tainan/5079/98) [TaxId: 231417]} gdpiadmlqvlptaanteassdknlietrcvlnhhstqetaignffsraglvsiitmptt gtqntdgyvnwdidlmgyaqlrrkcelftymrfdaeftfvvakpngelvpqllqymyvpp gapkptsrdsfawqtatnpsvfvkmtdppaqvsvpfmspasayqwfydgyptfgehlqan dldygqcpnnmmgtfsirtvgteksphsitlrvymrikhvrawiprplrnqpylfktnpn ykgndikctstsrdkittl
Timeline for d5c8ca_: