Lineage for d5c8ca_ (5c8c A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2075626Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2076195Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2076196Protein automated matches [190988] (13 species)
    not a true protein
  7. 2076197Species Coxsackievirus a16 (strain tainan/5079/98) [TaxId:231417] [277502] (1 PDB entry)
  8. 2076198Domain d5c8ca_: 5c8c A: [277503]
    Other proteins in same PDB: d5c8cc_
    automated match to d4ceya_
    complexed with cl, k, ste

Details for d5c8ca_

PDB Entry: 5c8c (more details), 2.5 Å

PDB Description: crystal structure of recombinant coxsackievirus a16 capsid
PDB Compounds: (A:) vp1

SCOPe Domain Sequences for d5c8ca_:

Sequence, based on SEQRES records: (download)

>d5c8ca_ b.121.4.0 (A:) automated matches {Coxsackievirus a16 (strain tainan/5079/98) [TaxId: 231417]}
gdpiadmidqtvnnqvnrsltalqvlptaanteasshrlgtgvvpalqaaetgassnasd
knlietrcvlnhhstqetaignffsraglvsiitmpttgtqntdgyvnwdidlmgyaqlr
rkcelftymrfdaeftfvvakpngelvpqllqymyvppgapkptsrdsfawqtatnpsvf
vkmtdppaqvsvpfmspasayqwfydgyptfgehlqandldygqcpnnmmgtfsirtvgt
eksphsitlrvymrikhvrawiprplrnqpylfktnpnykgndikctstsrdkittl

Sequence, based on observed residues (ATOM records): (download)

>d5c8ca_ b.121.4.0 (A:) automated matches {Coxsackievirus a16 (strain tainan/5079/98) [TaxId: 231417]}
gdpiadmlqvlptaanteassdknlietrcvlnhhstqetaignffsraglvsiitmptt
gtqntdgyvnwdidlmgyaqlrrkcelftymrfdaeftfvvakpngelvpqllqymyvpp
gapkptsrdsfawqtatnpsvfvkmtdppaqvsvpfmspasayqwfydgyptfgehlqan
dldygqcpnnmmgtfsirtvgteksphsitlrvymrikhvrawiprplrnqpylfktnpn
ykgndikctstsrdkittl

SCOPe Domain Coordinates for d5c8ca_:

Click to download the PDB-style file with coordinates for d5c8ca_.
(The format of our PDB-style files is described here.)

Timeline for d5c8ca_: