Lineage for d5c28b_ (5c28 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1753307Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1753308Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1753715Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 1753716Protein automated matches [190983] (6 species)
    not a true protein
  7. 1753717Species Human (Homo sapiens) [TaxId:9606] [188676] (86 PDB entries)
  8. 1753771Domain d5c28b_: 5c28 B: [277501]
    automated match to d2ourb_
    complexed with 4xv, mg, zn

Details for d5c28b_

PDB Entry: 5c28 (more details), 1.56 Å

PDB Description: pde10 complexed with 6-chloro-2-cyclopropyl-5-methyl-pyrimidin-4-amine
PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5c28b_:

Sequence, based on SEQRES records: (download)

>d5c28b_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
hrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleii
rkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtk
ltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilp
ptepllkacrdnlsqwekvirgeetatwis

Sequence, based on observed residues (ATOM records): (download)

>d5c28b_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
hrgfsnyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyf
gnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwae
gdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdnl
sqwekvirgeetatwis

SCOPe Domain Coordinates for d5c28b_:

Click to download the PDB-style file with coordinates for d5c28b_.
(The format of our PDB-style files is described here.)

Timeline for d5c28b_:

  • d5c28b_ appears in periodic updates to SCOPe 2.05 starting on 2015-09-30
  • d5c28b_ is called d5c28b1 in SCOPe 2.06
  • d5c28b_ appears in the current release, SCOPe 2.07, called d5c28b1