Lineage for d1cyg_3 (1cyg 403-491)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17288Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 17289Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 17290Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins)
  6. 17324Protein Cyclodextrin glycosyltransferase [51018] (5 species)
  7. 17361Species Bacillus stearothermophilus [TaxId:1422] [51020] (1 PDB entry)
  8. 17362Domain d1cyg_3: 1cyg 403-491 [27750]
    Other proteins in same PDB: d1cyg_1, d1cyg_2, d1cyg_4

Details for d1cyg_3

PDB Entry: 1cyg (more details), 2.5 Å

PDB Description: cyclodextrin glucanotransferase (e.c.2.4.1.19) (cgtase)

SCOP Domain Sequences for d1cyg_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cyg_3 b.71.1.1 (403-491) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus}
gdteqrwingdvyvyerqfgkdvvlvavnrssssnysitglftalpagtytdqlgglldg
ntiqvgsngsvnafdlgpgevgvwaysat

SCOP Domain Coordinates for d1cyg_3:

Click to download the PDB-style file with coordinates for d1cyg_3.
(The format of our PDB-style files is described here.)

Timeline for d1cyg_3: