SCOPe 2.06: Domain d5c1wa1: 5c1w A:439-761

Lineage for d5c1wa1 (5c1w A:439-761)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (111 PDB entries)

8. Domain d5c1wa1: 5c1w A:439-761 [277494]
   Other proteins in same PDB: d5c1wa2, d5c1wb2
   automated match to d2ourb_
   complexed with 4xs, mg, zn

Details for d5c1wa1

PDB Entry: 5c1w, 1.7 Å

PDB Description: pde10 complexed with 4,6-dichloro-2-cyclopropyl-5-methyl-pyrimidine

PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5c1wa1:

Sequence; same for both SEQRES and ATOM records:

>d5c1wa1 a.211.1.0 (A:439-761) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirgeet

Timeline for d5c1wa1:

• d5c1wa1 first appeared in SCOPe 2.05, called d5c1wa_
  
• d5c1wa1 appears in SCOPe 2.07
  
• d5c1wa1 appears in the current release, SCOPe 2.08