![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
![]() | Domain d5anma1: 5anm A:2-112 [277486] Other proteins in same PDB: d5anma2, d5anmb_, d5anmc2, d5anmd_, d5anme1, d5anme2, d5anmf1, d5anmf2, d5anmg1, d5anmg2, d5anmh_, d5anml1, d5anml2 automated match to d1aqkl1 |
PDB Entry: 5anm (more details), 2.85 Å
SCOPe Domain Sequences for d5anma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5anma1 b.1.1.1 (A:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]} svltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapklliydnfnrpsgvp drfsgsksgtsaslaitglqaedeadyycqsydsptltspfgtgtkltvlg
Timeline for d5anma1: