SCOPe 2.05: Domain d5anmc2: 5anm C:113-214

Lineage for d5anmc2 (5anm C:113-214)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (14 species)
not a true protein
Species Homo sapiens [TaxId:9606] [268989] (70 PDB entries)
Domain d5anmc2: 5anm C:113-214 [277485]
Other proteins in same PDB: d5anma1, d5anmc1, d5anml1
automated match to d1aqkl2

Details for d5anmc2

PDB Entry: 5anm (more details), 2.85 Å

PDB Description: crystal structure of ige fc in complex with a neutralizing antibody

PDB Compounds: (C:) immunoglobulin g

SCOPe Domain Sequences for d5anmc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5anmc2 b.1.1.2 (C:113-214) automated matches {Homo sapiens [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d5anmc2:

Click to download the PDB-style file with coordinates for d5anmc2.
(The format of our PDB-style files is described here.)

Timeline for d5anmc2: