Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Homo sapiens [TaxId:9606] [268989] (70 PDB entries) |
Domain d5anmc2: 5anm C:113-214 [277485] Other proteins in same PDB: d5anma1, d5anmc1, d5anml1 automated match to d1aqkl2 |
PDB Entry: 5anm (more details), 2.85 Å
SCOPe Domain Sequences for d5anmc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5anmc2 b.1.1.2 (C:113-214) automated matches {Homo sapiens [TaxId: 9606]} qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvapt
Timeline for d5anmc2: