Lineage for d5anmc1 (5anm C:2-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743315Domain d5anmc1: 5anm C:2-112 [277484]
    Other proteins in same PDB: d5anma2, d5anmb_, d5anmc2, d5anmd_, d5anme1, d5anme2, d5anmf1, d5anmf2, d5anmg1, d5anmg2, d5anmh_, d5anml1, d5anml2
    automated match to d1aqkl1

Details for d5anmc1

PDB Entry: 5anm (more details), 2.85 Å

PDB Description: crystal structure of ige fc in complex with a neutralizing antibody
PDB Compounds: (C:) immunoglobulin g

SCOPe Domain Sequences for d5anmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5anmc1 b.1.1.1 (C:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapklliydnfnrpsgvp
drfsgsksgtsaslaitglqaedeadyycqsydsptltspfgtgtkltvlg

SCOPe Domain Coordinates for d5anmc1:

Click to download the PDB-style file with coordinates for d5anmc1.
(The format of our PDB-style files is described here.)

Timeline for d5anmc1: