Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d5anml1: 5anm L:3-110 [277480] Other proteins in same PDB: d5anma1, d5anma2, d5anmc1, d5anmc2, d5anme1, d5anme2, d5anmf1, d5anmf2, d5anmg1, d5anmg2, d5anml2 automated match to d3n9gl1 |
PDB Entry: 5anm (more details), 2.85 Å
SCOPe Domain Sequences for d5anml1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5anml1 b.1.1.0 (L:3-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} vltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapklliydnfnrpsgvpd rfsgsksgtsaslaitglqaedeadyycqsydsptltspfgtgtkltv
Timeline for d5anml1: