Lineage for d1cxf_3 (1cxf 407-495)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63005Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 63006Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 63007Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins)
  6. 63051Protein Cyclodextrin glycosyltransferase [51018] (5 species)
  7. 63052Species Bacillus circulans, different strains [TaxId:1397] [51019] (27 PDB entries)
  8. 63078Domain d1cxf_3: 1cxf 407-495 [27748]
    Other proteins in same PDB: d1cxf_1, d1cxf_2, d1cxf_4

Details for d1cxf_3

PDB Entry: 1cxf (more details), 2.6 Å

PDB Description: complex of a (d229n/e257q) double mutant cgtase from bacillus circulans strain 251 with maltotetraose at 120 k and ph 9.1 obtained after soaking the crystal with alpha-cyclodextrin
PDB Compounds: ( :)

SCOP Domain Sequences for d1cxf_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxf_3 b.71.1.1 (407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaa

SCOP Domain Coordinates for d1cxf_3:

Click to download the PDB-style file with coordinates for d1cxf_3.
(The format of our PDB-style files is described here.)

Timeline for d1cxf_3: