SCOPe 2.06: Domain d5anme2: 5anm E:439-543

Lineage for d5anme2 (5anm E:439-543)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d5anme2: 5anm E:439-543 [277477]
   Other proteins in same PDB: d5anma1, d5anmc1, d5anml1
   automated match to d1f6ab2

Details for d5anme2

PDB Entry: 5anm, 2.85 Å

PDB Description: crystal structure of ige fc in complex with a neutralizing antibody

PDB Compounds: (E:) ig epsilon chain c region

SCOPe Domain Sequences for d5anme2:

Sequence, based on SEQRES records:

>d5anme2 b.1.1.2 (E:439-543) automated matches {Human (Homo sapiens) [TaxId: 9606]}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsv

Sequence, based on observed residues (ATOM records):

>d5anme2 b.1.1.2 (E:439-543) automated matches {Human (Homo sapiens) [TaxId: 9606]}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgffvfsrlevtraeweqkdeficravheaaspsqtvqravsv

Timeline for d5anme2:

• d5anme2 first appeared in SCOPe 2.05
  
• d5anme2 appears in SCOPe 2.07
  
• d5anme2 appears in the current release, SCOPe 2.08