Lineage for d5amva_ (5amv A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069178Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069179Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2069180Family b.80.1.1: Pectate lyase-like [51127] (3 protein domains)
  6. 2069216Protein automated matches [190887] (1 species)
    not a true protein
  7. 2069217Species Bacillus subtilis [TaxId:1423] [188279] (8 PDB entries)
  8. 2069223Domain d5amva_: 5amv A: [277469]
    automated match to d3krga_
    complexed with act, ca, gol

Details for d5amva_

PDB Entry: 5amv (more details), 1.57 Å

PDB Description: structural insights into the loss of catalytic competence in pectate lyase at low ph
PDB Compounds: (A:) pectate lyase

SCOPe Domain Sequences for d5amva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5amva_ b.80.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
adlghqtlgsndgwgaystgttggskasssnvytvsnrnqlvsalgketnttpkiiyikg
tidmnvddnlkplglndykdpeydldkylkaydpstwgkkepsgtqeeararsqknqkar
vmvdipanttivgsgtnakvvggnfqiksdnviirniefqdaydyfpqwdptdgssgnwn
sqydnitinggthiwidhctfndgsrpdstspkyygrkyqhhdgqtdasnganyitmsyn
yyhdhdkssifgssdsktsddgklkitlhhnryknivqraprvrfgqvhvynnyyegsts
sssypfsyawgigksskiyaqnnvidvpglsaaktisvfsggtalydsgtllngtqinas
aanglsssvgwtpslhgsidasanvksnvinqagagkln

SCOPe Domain Coordinates for d5amva_:

Click to download the PDB-style file with coordinates for d5amva_.
(The format of our PDB-style files is described here.)

Timeline for d5amva_: