Lineage for d4zzwa_ (4zzw A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043561Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 protein domains)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2043619Protein automated matches [190170] (16 species)
    not a true protein
  7. 2043631Species Galactomyces geotrichum [TaxId:1173061] [277463] (1 PDB entry)
  8. 2043632Domain d4zzwa_: 4zzw A: [277464]
    automated match to d1gpia_
    complexed with cbi, gol, man, mg, nag, peg

Details for d4zzwa_

PDB Entry: 4zzw (more details), 1.5 Å

PDB Description: geotrichum candidum cel7a structure complex with cellobiose at 1.5a
PDB Compounds: (A:) cellobiohydrolase I

SCOPe Domain Sequences for d4zzwa_:

Sequence, based on SEQRES records: (download)

>d4zzwa_ b.29.1.10 (A:) automated matches {Galactomyces geotrichum [TaxId: 1173061]}
eqigtlttethppltwqtctsggscttnngkvvldanwrwlhstsgstncytgntwnttl
cpddttcaqncaldgadyegtygitasgnslrlnfvtngsqknvgsrtylmkddthyqtf
nllnqeftfdvdvsglpcglngalymvpmaadggvsnepnnkagaqygvgycdsqcprdl
kfiagsanvqgwepasnsansglggngsccaeldiweansisaaltphsadtvtqtvcng
ddcggtysndrysgttdpdgcdfnsyrqgdtsfygpgktvdtnskftvvtqfltdssgnl
neikrfyvqngvvipnsqstiagisgnsitqdyctaqkqvfgdtntwedhggfqsmtnaf
kagmvlvmslwddyyadmlwldsvayptdadpstpgvargtcsttsgvpsdiessaasay
viysnikvgpinstfsgt

Sequence, based on observed residues (ATOM records): (download)

>d4zzwa_ b.29.1.10 (A:) automated matches {Galactomyces geotrichum [TaxId: 1173061]}
eqigtlttethppltwqtctsggscttnngkvvldanwrwlhstsgstncytgntwnttl
cpddttcaqncaldgadyegtygitasgnslrlnfvtngsqknvgsrtylmkddthyqtf
nllnqeftfdvdvsglpcglngalymvpmaadggvsnepnnkagaqygvgycdsqcprdl
kfiagsanvqgwepasnsglggngsccaeldiweansisaaltphsadtvtqtvcngddc
ggtysndrysgttdpdgcdfnsyrqgdtsfygpgktvdtnskftvvtqfltdssgnlnei
krfyvqngvvipnsqstiagisgnsitqdyctaqkqvfgdtntwedhggfqsmtnafkag
mvlvmslwddyyadmlwldsvayptdadpstpgvargtcsttsgvpsdiessaasayviy
snikvgpinstfsgt

SCOPe Domain Coordinates for d4zzwa_:

Click to download the PDB-style file with coordinates for d4zzwa_.
(The format of our PDB-style files is described here.)

Timeline for d4zzwa_: