Lineage for d4zzta_ (4zzt A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043561Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 protein domains)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2043619Protein automated matches [190170] (16 species)
    not a true protein
  7. 2043627Species Galactomyces candidum [TaxId:1173061] [277062] (3 PDB entries)
  8. 2043629Domain d4zzta_: 4zzt A: [277462]
    automated match to d1gpia_
    complexed with bgc, gol, mg, nag, sgc

Details for d4zzta_

PDB Entry: 4zzt (more details), 1.56 Å

PDB Description: geotrichum candidum cel7a structure complex with thio- linked cellotriose at 1.56a
PDB Compounds: (A:) cellobiohydrolase cel7a

SCOPe Domain Sequences for d4zzta_:

Sequence, based on SEQRES records: (download)

>d4zzta_ b.29.1.10 (A:) automated matches {Galactomyces candidum [TaxId: 1173061]}
eqigtlttethppltwqtctsggscttnngkvvldanwrwlhstsgstncytgntwnttl
cpddttcaqncaldgadyegtygitasgnslrlnfvtngsqknvgsrtylmkddthyqtf
nllnqeftfdvdvsglpcglngalymvpmaadggvsnepnnkagaqygvgycdsqcprdl
kfiagsanvqgwepasnsansglggngsccaeldiweansisaaltphsadtvtqtvcng
ddcggtysndrysgttdpdgcdfnsyrqgdtsfygpgktvdtnskftvvtqfltdssgnl
neikrfyvqngvvipnsqstiagisgnsitqdyctaqkqvfgdtntwedhggfqsmtnaf
kagmvlvmslwddyyadmlwldsvayptdadpstpgvargtcsttsgvpsdiessaasay
viysnikvgpinstfsgt

Sequence, based on observed residues (ATOM records): (download)

>d4zzta_ b.29.1.10 (A:) automated matches {Galactomyces candidum [TaxId: 1173061]}
eqigtlttethppltwqtctsggscttnngkvvldanwrwlhstsgstncytgntwnttl
cpddttcaqncaldgadyegtygitasgnslrlnfvtngsqknvgsrtylmkddthyqtf
nllnqeftfdvdvsglpcglngalymvpmaadggvsnepnnkagaqygvgycdsqcprdl
kfiagsanvqgwepansglggngsccaeldiweansisaaltphsadtvtqtvcngddcg
gtysndrysgttdpdgcdfnsyrqgdtsfygpgktvdtnskftvvtqfltdssgnlneik
rfyvqngvvipnsqstiagisgnsitqdyctaqkqvfgdtntwedhggfqsmtnafkagm
vlvmslwddyyadmlwldsvayptdadpstpgvargtcsttsgvpsdiessaasayviys
nikvgpinstfsgt

SCOPe Domain Coordinates for d4zzta_:

Click to download the PDB-style file with coordinates for d4zzta_.
(The format of our PDB-style files is described here.)

Timeline for d4zzta_: