Lineage for d4zzva_ (4zzv A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779928Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2779993Protein automated matches [190170] (17 species)
    not a true protein
  7. 2780004Species Galactomyces candidum [TaxId:1173061] [277062] (3 PDB entries)
  8. 2780005Domain d4zzva_: 4zzv A: [277461]
    automated match to d1gpia_
    complexed with man, mg, nag

Details for d4zzva_

PDB Entry: 4zzv (more details), 1.37 Å

PDB Description: geotrichum candidum cel7a apo structure at 1.4a
PDB Compounds: (A:) cellobiohydrolase I

SCOPe Domain Sequences for d4zzva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zzva_ b.29.1.10 (A:) automated matches {Galactomyces candidum [TaxId: 1173061]}
eqigtlttethppltwqtctsggscttnngkvvldanwrwlhstsgstncytgntwnttl
cpddttcaqncaldgadyegtygitasgnslrlnfvtngsqknvgsrtylmkddthyqtf
nllnqeftfdvdvsglpcglngalymvpmaadggvsnepnnkagaqygvgycdsqcprdl
kfiagsanvqgwepasnsansglggngsccaeldiweansisaaltphsadtvtqtvcng
ddcggtysndrysgttdpdgcdfnsyrqgdtsfygpgktvdtnskftvvtqfltdssgnl
neikrfyvqngvvipnsqstiagisgnsitqdyctaqkqvfgdtntwedhggfqsmtnaf
kagmvlvmslwddyyadmlwldsvayptdadpstpgvargtcsttsgvpsdiessaasay
viysnikvgpinstfs

SCOPe Domain Coordinates for d4zzva_:

Click to download the PDB-style file with coordinates for d4zzva_.
(The format of our PDB-style files is described here.)

Timeline for d4zzva_: