Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Mus musculus [TaxId:10090] [272441] (35 PDB entries) |
Domain d4yxhl2: 4yxh L:108-213 [277458] Other proteins in same PDB: d4yxha_, d4yxhl1 automated match to d4h88l2 complexed with na |
PDB Entry: 4yxh (more details), 2.7 Å
SCOPe Domain Sequences for d4yxhl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yxhl2 b.1.1.2 (L:108-213) automated matches {Mus musculus [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnsetdqd skdstysmsstltltkdeyerhntytceathktstspivksfnrne
Timeline for d4yxhl2: