Lineage for d4yxhl1 (4yxh L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761046Domain d4yxhl1: 4yxh L:1-107 [277457]
    Other proteins in same PDB: d4yxha_, d4yxhh1, d4yxhh2, d4yxhl2
    automated match to d4h88l1
    complexed with na

Details for d4yxhl1

PDB Entry: 4yxh (more details), 2.7 Å

PDB Description: crystal structure of deer prion protein complexed with pom1 fab
PDB Compounds: (L:) POM1 Fab Light chain

SCOPe Domain Sequences for d4yxhl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yxhl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspailsvspgervsfscrasqnigtsihwyqqrtnesprliikyasesisgips
rfsgsgsgtdftlsinsvesediadyycqqsntwpytfgggtklelk

SCOPe Domain Coordinates for d4yxhl1:

Click to download the PDB-style file with coordinates for d4yxhl1.
(The format of our PDB-style files is described here.)

Timeline for d4yxhl1: