Lineage for d1cgua3 (1cgu A:407-494)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400341Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 protein domains)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2400495Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 2400496Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)
  8. 2400524Domain d1cgua3: 1cgu A:407-494 [27745]
    Other proteins in same PDB: d1cgua1, d1cgua2, d1cgua4
    complexed with ca

Details for d1cgua3

PDB Entry: 1cgu (more details), 2.5 Å

PDB Description: catalytic center of cyclodextrin glycosyltransferase derived from x-ray structure analysis combined with site-directed mutagenesis
PDB Compounds: (A:) cyclodextrin glycosyl-transferase

SCOPe Domain Sequences for d1cgua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgua3 b.71.1.1 (A:407-494) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
gstqqrwinndvyvyerkfgksvavvavnrnlstsasitglstslptgsytdvlggvlng
nnitstngsinnftlaagatavwqytta

SCOPe Domain Coordinates for d1cgua3:

Click to download the PDB-style file with coordinates for d1cgua3.
(The format of our PDB-style files is described here.)

Timeline for d1cgua3: