Lineage for d4z8mb1 (4z8m B:350-504)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2368843Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2368844Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 2368845Family b.8.1.1: MATH domain [49600] (5 protein domains)
    automatically mapped to Pfam PF00917
  6. 2368925Protein automated matches [277441] (1 species)
    not a true protein
  7. 2368926Species Human (Homo sapiens) [TaxId:9606] [277442] (1 PDB entry)
  8. 2368928Domain d4z8mb1: 4z8m B:350-504 [277446]
    Other proteins in same PDB: d4z8mb2
    automated match to d1lb4a_

Details for d4z8mb1

PDB Entry: 4z8m (more details), 2.95 Å

PDB Description: crystal structure of the mavs-traf6 complex
PDB Compounds: (B:) TNF receptor-associated factor 6

SCOPe Domain Sequences for d4z8mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z8mb1 b.8.1.1 (B:350-504) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ngiyiwkignfgmhlkcqeeekpvvihspgfytgkpgyklcmrlhlqlptaqrcanyisl
fvhtmqgeydshlpwpfqgtirltildqseapvrqnheeimdakpellafqrptiprnpk
gfgyvtfmhlealrqrtfikddtllvrcevstrfd

SCOPe Domain Coordinates for d4z8mb1:

Click to download the PDB-style file with coordinates for d4z8mb1.
(The format of our PDB-style files is described here.)

Timeline for d4z8mb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4z8mb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4z8ma_