SCOPe 2.08: Domain d4z8mb1: 4z8m B:350-504

Lineage for d4z8mb1 (4z8m B:350-504)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (3 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.1: MATH domain [49600] (5 proteins)
   automatically mapped to Pfam PF00917

6. Protein automated matches [277441] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [277442] (1 PDB entry)

8. Domain d4z8mb1: 4z8m B:350-504 [277446]
   Other proteins in same PDB: d4z8mb2
   automated match to d1lb4a_

Details for d4z8mb1

PDB Entry: 4z8m, 2.95 Å

PDB Description: crystal structure of the mavs-traf6 complex

PDB Compounds: (B:) TNF receptor-associated factor 6

SCOPe Domain Sequences for d4z8mb1:

Sequence; same for both SEQRES and ATOM records:

>d4z8mb1 b.8.1.1 (B:350-504) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ngiyiwkignfgmhlkcqeeekpvvihspgfytgkpgyklcmrlhlqlptaqrcanyisl
fvhtmqgeydshlpwpfqgtirltildqseapvrqnheeimdakpellafqrptiprnpk
gfgyvtfmhlealrqrtfikddtllvrcevstrfd

Timeline for d4z8mb1:

• d4z8mb1 first appeared in SCOPe 2.05, called d4z8mb_
  
• d4z8mb1 appears in SCOPe 2.07