Lineage for d4z8ma_ (4z8m A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773292Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773293Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 2773294Family b.8.1.1: MATH domain [49600] (5 proteins)
    automatically mapped to Pfam PF00917
  6. 2773391Protein automated matches [277441] (1 species)
    not a true protein
  7. 2773392Species Human (Homo sapiens) [TaxId:9606] [277442] (1 PDB entry)
  8. 2773393Domain d4z8ma_: 4z8m A: [277443]
    Other proteins in same PDB: d4z8mb2
    automated match to d1lb4a_

Details for d4z8ma_

PDB Entry: 4z8m (more details), 2.95 Å

PDB Description: crystal structure of the mavs-traf6 complex
PDB Compounds: (A:) TNF receptor-associated factor 6

SCOPe Domain Sequences for d4z8ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z8ma_ b.8.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ngiyiwkignfgmhlkcqeeekpvvihspgfytgkpgyklcmrlhlqlptaqrcanyisl
fvhtmqgeydshlpwpfqgtirltildqseapvrqnheeimdakpellafqrptiprnpk
gfgyvtfmhlealrqrtfikddtllvrcevst

SCOPe Domain Coordinates for d4z8ma_:

Click to download the PDB-style file with coordinates for d4z8ma_.
(The format of our PDB-style files is described here.)

Timeline for d4z8ma_: