| Class b: All beta proteins [48724] (180 folds) |
| Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.8.1: TRAF domain-like [49599] (3 families) ![]() has a circularly permuted immunoglobulin-fold topology with extra strand |
| Family b.8.1.1: MATH domain [49600] (5 proteins) automatically mapped to Pfam PF00917 |
| Protein automated matches [277441] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [277442] (1 PDB entry) |
| Domain d4z8ma_: 4z8m A: [277443] Other proteins in same PDB: d4z8mb2 automated match to d1lb4a_ |
PDB Entry: 4z8m (more details), 2.95 Å
SCOPe Domain Sequences for d4z8ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z8ma_ b.8.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ngiyiwkignfgmhlkcqeeekpvvihspgfytgkpgyklcmrlhlqlptaqrcanyisl
fvhtmqgeydshlpwpfqgtirltildqseapvrqnheeimdakpellafqrptiprnpk
gfgyvtfmhlealrqrtfikddtllvrcevst
Timeline for d4z8ma_: