Lineage for d4yz4b2 (4yz4 B:274-740)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1802176Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1802177Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1802584Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 1802585Protein automated matches [190692] (11 species)
    not a true protein
  7. 1802728Species Streptococcus pneumoniae [TaxId:1313] [277389] (8 PDB entries)
  8. 1802738Domain d4yz4b2: 4yz4 B:274-740 [277440]
    Other proteins in same PDB: d4yz4a1, d4yz4b1
    automated match to d2slia2
    complexed with sia, so4

Details for d4yz4b2

PDB Entry: 4yz4 (more details), 2.15 Å

PDB Description: crystal structure of streptococcus pneumoniae nanc, in complex with n- acetylneuraminic acid.
PDB Compounds: (B:) Sialidase, NanC

SCOPe Domain Sequences for d4yz4b2:

Sequence, based on SEQRES records: (download)

>d4yz4b2 b.68.1.0 (B:274-740) automated matches {Streptococcus pneumoniae [TaxId: 1313]}
ghliytandttgsnyfripvlytfsngrvfssidaryggthdflnkiniatsysddngkt
wtkpkltlafddfapvplewprevggrdlqisggatyidsvivekknkqvlmfadvmpag
vsfreatrkdsgykqidgnyylklrkqgdtdynytirengtvyddrtnrptefsvdknfg
ikqngnyltveqysvsfennkkteyrngtkvhmnifykdalfkvvptnyiayissndhge
swsaptllppimglnrnapylgpgrgiiesstgrilipsytgkesafiysddngaswkvk
vvplpsswsaeaqfvelspgviqaymrtnngkiayltskdagttwsapeylkfvsnpsyg
tqlsiinysqlidgkkavilstpnstngrkhgqiwiglinddntidwryhhdvdysnygy
systltelpnheiglmfekfdswsrnelhmknvvpyitfkiedlkkn

Sequence, based on observed residues (ATOM records): (download)

>d4yz4b2 b.68.1.0 (B:274-740) automated matches {Streptococcus pneumoniae [TaxId: 1313]}
ghliytandttgsnyfripvlytfsngrvfssidaryggthdflnkiniatsysddngkt
wtkpkltlafddfapvplewprevggrdlqisggatyidsvivekknkqvlmfadvmpag
vsfreatrkdsgykqidgnyylklrkqgdtdynytirengtvyddrtnrptefsvdknfg
ikqngnyltveqysvsfekkteyrngtkvhmnifykdalfkvvptnyiayissndhgesw
saptllppimglnrnapylgpgrgiiesstgrilipsytgkesafiysddngaswkvkvv
plpsswsaeaqfvelspgviqaymrtnngkiayltskdagttwsapeylkfvsnpsygtq
lsiinysqlidgkkavilstpnstngrkhgqiwiglinddntidwryhhdvdysnygysy
stltelpnheiglmfekfdswsrnelhmknvvpyitfkiedlkkn

SCOPe Domain Coordinates for d4yz4b2:

Click to download the PDB-style file with coordinates for d4yz4b2.
(The format of our PDB-style files is described here.)

Timeline for d4yz4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4yz4b1