| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [277387] (9 PDB entries) |
| Domain d4yz4b1: 4yz4 B:84-273 [277439] Other proteins in same PDB: d4yz4a2, d4yz4a3, d4yz4b2, d4yz4b3 automated match to d2slia1 complexed with sia, so4 |
PDB Entry: 4yz4 (more details), 2.15 Å
SCOPe Domain Sequences for d4yz4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yz4b1 b.29.1.0 (B:84-273) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqqn
syvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktysl
yangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldeet
vkkmttnavt
Timeline for d4yz4b1: