Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (66 species) not a true protein |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [277387] (9 PDB entries) |
Domain d4yz5a1: 4yz5 A:84-273 [277437] Other proteins in same PDB: d4yz5a2, d4yz5b2, d4yz5b3 automated match to d2slia1 complexed with dan, slt, so4 |
PDB Entry: 4yz5 (more details), 2.27 Å
SCOPe Domain Sequences for d4yz5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yz5a1 b.29.1.0 (A:84-273) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} tpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqqn syvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktysl yangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldeet vkkmttnavt
Timeline for d4yz5a1: