Lineage for d4yz1b2 (4yz1 B:274-740)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2065391Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2065392Protein automated matches [190692] (15 species)
    not a true protein
  7. 2065556Species Streptococcus pneumoniae [TaxId:170187] [277429] (2 PDB entries)
  8. 2065558Domain d4yz1b2: 4yz1 B:274-740 [277434]
    Other proteins in same PDB: d4yz1a1, d4yz1b1, d4yz1b3
    automated match to d2slia2
    complexed with so4

Details for d4yz1b2

PDB Entry: 4yz1 (more details), 1.97 Å

PDB Description: crystal structure of streptococcus pneumoniae nanc, apo structure.
PDB Compounds: (B:) Putative neuraminidase

SCOPe Domain Sequences for d4yz1b2:

Sequence, based on SEQRES records: (download)

>d4yz1b2 b.68.1.0 (B:274-740) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
ghliytandttgsnyfripvlytfsngrvfssidaryggthdflnkiniatsysddngkt
wtkpkltlafddfapvplewprevggrdlqisggatyidsvivekknkqvlmfadvmpag
vsfreatrkdsgykqidgnyylklrkqgdtdynytirengtvyddrtnrptefsvdknfg
ikqngnyltveqysvsfennkkteyrngtkvhmnifykdalfkvvptnyiayissndhge
swsaptllppimglnrnapylgpgrgiiesstgrilipsytgkesafiysddngaswkvk
vvplpsswsaeaqfvelspgviqaymrtnngkiayltskdagttwsapeylkfvsnpsyg
tqlsiinysqlidgkkavilstpnstngrkhgqiwiglinddntidwryhhdvdysnygy
systltelpnheiglmfekfdswsrnelhmknvvpyitfkiedlkkn

Sequence, based on observed residues (ATOM records): (download)

>d4yz1b2 b.68.1.0 (B:274-740) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
ghliytandttgsnyfripvlytfsngrvfssidaryggthdflnkiniatsysddngkt
wtkpkltlafddfapvplewprevggrdlqisggatyidsvivekknkqvlmfadvmpag
vsfreatrkdsgykqidgnyylklrkqgdtdynytirengtvyddrtnrptefsvdknfg
ikqngnyltveqysvsfekkteyrngtkvhmnifykdalfkvvptnyiayissndhgesw
saptllppimglnrnapylgpgrgiiesstgrilipsytgkesafiysddngaswkvkvv
plpsswsaeaqfvelspgviqaymrtnngkiayltskdagttwsapeylkfvsnpsygtq
lsiinysqlidgkkavilstpnstngrkhgqiwiglinddntidwryhhdvdysnygysy
stltelpnheiglmfekfdswsrnelhmknvvpyitfkiedlkkn

SCOPe Domain Coordinates for d4yz1b2:

Click to download the PDB-style file with coordinates for d4yz1b2.
(The format of our PDB-style files is described here.)

Timeline for d4yz1b2: