![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Streptococcus pneumoniae [TaxId:170187] [277427] (2 PDB entries) |
![]() | Domain d4yz1b1: 4yz1 B:84-273 [277433] Other proteins in same PDB: d4yz1a2, d4yz1b2, d4yz1b3 automated match to d2slia1 complexed with so4 |
PDB Entry: 4yz1 (more details), 1.97 Å
SCOPe Domain Sequences for d4yz1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yz1b1 b.29.1.0 (B:84-273) automated matches {Streptococcus pneumoniae [TaxId: 170187]} tpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqqn syvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktysl yangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldeet vkkmttnavt
Timeline for d4yz1b1: