SCOPe 2.07: Domain d4yz2b1: 4yz2 B:84-273

Lineage for d4yz2b1 (4yz2 B:84-273)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (66 species)
   not a true protein

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [277387] (9 PDB entries)

8. Domain d4yz2b1: 4yz2 B:84-273 [277431]
   Other proteins in same PDB: d4yz2a2, d4yz2b2, d4yz2b3
   automated match to d2slia1
   complexed with dan, so4

Details for d4yz2b1

PDB Entry: 4yz2, 2.06 Å

PDB Description: crystal structure of streptococcus pneumoniae nanc, in complex with 2- deoxy-2,3-didehydro-n-acetylneuraminic acid.

PDB Compounds: (B:) Sialidase NanC

SCOPe Domain Sequences for d4yz2b1:

Sequence; same for both SEQRES and ATOM records:

>d4yz2b1 b.29.1.0 (B:84-273) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqqn
syvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktysl
yangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldeet
vkkmttnavt

Timeline for d4yz2b1:

• d4yz2b1 first appeared in SCOPe 2.05
  
• d4yz2b1 appears in SCOPe 2.06
  
• d4yz2b1 appears in the current release, SCOPe 2.08