![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Cyclodextrin glycosyltransferase [51018] (5 species) contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like |
![]() | Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries) |
![]() | Domain d2dija3: 2dij A:407-496 [27743] Other proteins in same PDB: d2dija1, d2dija2, d2dija4 complexed with adh, ca; mutant |
PDB Entry: 2dij (more details), 2.6 Å
SCOPe Domain Sequences for d2dija3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dija3 b.71.1.1 (A:407-496) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]} gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng ntlsvgsggaasnftlaaggtavwqytaat
Timeline for d2dija3: