Lineage for d2dij_3 (2dij 407-496)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (14 proteins) 
Protein Cyclodextrin glycosyltransferase [51018] (5 species) 
Species Bacillus circulans, different strains [TaxId:1397] [51019] (29 PDB entries) 
Domain d2dij_3: 2dij 407-496 [27743]
Other proteins in same PDB: d2dij_1, d2dij_2, d2dij_4
Details for d2dij_3
PDB Entry: 2dij (more details), 2.6 Å
PDB Description: complex of a y195f mutant cgtase from b. circulans strain 251 complexed with a maltononaose inhibitor at ph 9.8 obtained after soaking the crystal with acarbose and maltohexaose
SCOP Domain Sequences for d2dij_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dij_3 b.71.1.1 (407-496) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaat
SCOP Domain Coordinates for d2dij_3:
Click to download the PDB-style file with coordinates for d2dij_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2dij_3:
- d2dij_3 first appeared (with stable ids) in SCOP 1.55
- d2dij_3 appears in SCOP 1.59
- d2dij_3 appears in SCOP 1.63
- d2dij_3 appears in the current release, SCOPe 2.08, called d2dija3
View in 3D
