Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
Superfamily d.6.1: Prion-like [54098] (1 family) |
Family d.6.1.1: Prion-like [54099] (3 proteins) |
Protein automated matches [191016] (9 species) not a true protein |
Species Odocoileus hemionus [TaxId:9872] [277423] (1 PDB entry) |
Domain d4yxha_: 4yxh A: [277424] Other proteins in same PDB: d4yxhl1, d4yxhl2 automated match to d4hlsb_ complexed with na |
PDB Entry: 4yxh (more details), 2.7 Å
SCOPe Domain Sequences for d4yxha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yxha_ d.6.1.1 (A:) automated matches {Odocoileus hemionus [TaxId: 9872]} lggymlgsamnrplihfgndyedryyrenmyrypnqvyyrpvdqynnqntfvhdcvnitv kqhtvttttkgenftetdikmmervveqmcitqyqresqay
Timeline for d4yxha_: