Lineage for d4yx2a_ (4yx2 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2498997Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 2498998Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 2498999Family d.6.1.1: Prion-like [54099] (3 protein domains)
  6. 2499063Protein automated matches [191016] (9 species)
    not a true protein
  7. 2499066Species Cow (Bos taurus) [TaxId:9913] [277419] (1 PDB entry)
  8. 2499067Domain d4yx2a_: 4yx2 A: [277420]
    Other proteins in same PDB: d4yx2l1, d4yx2l2
    automated match to d1fo7a_

Details for d4yx2a_

PDB Entry: 4yx2 (more details), 2.19 Å

PDB Description: crystal structure of bovine prion protein complexed with pom1 fab
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d4yx2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yx2a_ d.6.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
lggymlgsamsrplihfgsdyedryyrenmhrypnqvyyrpvdqysnqnnfvhdcvnitv
kehtvttttkgenftetdikmmervveqmcitqyqresqay

SCOPe Domain Coordinates for d4yx2a_:

Click to download the PDB-style file with coordinates for d4yx2a_.
(The format of our PDB-style files is described here.)

Timeline for d4yx2a_: