Lineage for d4yw9a2 (4yw9 A:260-622)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143071Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2143072Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2143073Family c.91.1.1: PEP carboxykinase C-terminal domain [53796] (3 protein domains)
  6. 2143074Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69612] (2 species)
  7. 2143084Species Norway rat (Rattus norvegicus) [TaxId:10116] [225316] (40 PDB entries)
  8. 2143104Domain d4yw9a2: 4yw9 A:260-622 [277416]
    Other proteins in same PDB: d4yw9a1, d4yw9a3
    automated match to d3dtba2
    complexed with 1pe, 1wd, gtp, mn, moh, na

Details for d4yw9a2

PDB Entry: 4yw9 (more details), 1.4 Å

PDB Description: structure of rat cytosolic pepck in complex with 3-mercaptopicolinic acid and gtp
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d4yw9a2:

Sequence, based on SEQRES records: (download)

>d4yw9a2 c.91.1.1 (A:260-622) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
wlaehmlilgitnpegkkkylaaafpsacgktnlammnptlpgwkvecvgddiawmkfda
qgnlrainpengffgvapgtsvktnpnaiktiqkntiftnvaetsdggvywegideplap
gvtitswknkewrpqdeepcahpnsrfctpasqcpiidpawespegvpiegiifggrrpa
gvplvyealswqhgvfvgaamrseataaaehkgkvimhdpfamrpffgynfgkylahwls
mahrpaaklpkifhvnwfrkdkngkflwpgfgensrvlewmfgriegedsakltpigyvp
kedalnlkglgdvnveelfgiskefwekeveeidkyledqvnadlpyeierelralkqri
sqm

Sequence, based on observed residues (ATOM records): (download)

>d4yw9a2 c.91.1.1 (A:260-622) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
wlaehmlilgitnpegkkkylaaafpsacgktnlammnptlpgwkvecvgddiawmkfda
qgnlrainpengffgvapgtsvktnpnaiktiqkntiftnvaetsdggvywegideplap
gvtitswknkewrpepcahpnsrfctpasqcpiidpawespegvpiegiifggrrpagvp
lvyealswqhgvfvgaamrseagkvimhdpfamrpffgynfgkylahwlsmahrpaaklp
kifhvnwfrkdkngkflwpgfgensrvlewmfgriegedsakltpigyvpkedalnlkgl
gdvnveelfgiskefwekeveeidkyledqvnadlpyeierelralkqrisqm

SCOPe Domain Coordinates for d4yw9a2:

Click to download the PDB-style file with coordinates for d4yw9a2.
(The format of our PDB-style files is described here.)

Timeline for d4yw9a2: