SCOPe 2.05: Domain d4yw9a1: 4yw9 A:-1-259

Lineage for d4yw9a1 (4yw9 A:-1-259)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families)

5. Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)

6. Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (29 PDB entries)

8. Domain d4yw9a1: 4yw9 A:-1-259 [277415]
   Other proteins in same PDB: d4yw9a2
   automated match to d3dt2a1
   complexed with 1pe, 1wd, gtp, mn, moh, na

Details for d4yw9a1

PDB Entry: 4yw9, 1.4 Å

PDB Description: structure of rat cytosolic pepck in complex with 3-mercaptopicolinic acid and gtp

PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d4yw9a1:

Sequence; same for both SEQRES and ATOM records:

>d4yw9a1 c.109.1.1 (A:-1-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gsmppqlhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrlla
hmqeegvirklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwms
eedfekafnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgt
svlealgdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggn
sllgkkcfalriasrlakeeg

Timeline for d4yw9a1:

• d4yw9a1 is new in SCOPe 2.05-stable
  
• d4yw9a1 appears in SCOPe 2.06
  
• d4yw9a1 appears in the current release, SCOPe 2.08