Lineage for d4yw9a1 (4yw9 A:1-259)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491927Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2491928Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2491929Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 protein domains)
  6. 2491930Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species)
  7. 2491940Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (40 PDB entries)
  8. 2491946Domain d4yw9a1: 4yw9 A:1-259 [277415]
    Other proteins in same PDB: d4yw9a2, d4yw9a3
    automated match to d3dt2a1
    complexed with 1pe, 1wd, gtp, mn, moh, na

Details for d4yw9a1

PDB Entry: 4yw9 (more details), 1.4 Å

PDB Description: structure of rat cytosolic pepck in complex with 3-mercaptopicolinic acid and gtp
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d4yw9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yw9a1 c.109.1.1 (A:1-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mppqlhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahm
qeegvirklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmsee
dfekafnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsv
lealgdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsl
lgkkcfalriasrlakeeg

SCOPe Domain Coordinates for d4yw9a1:

Click to download the PDB-style file with coordinates for d4yw9a1.
(The format of our PDB-style files is described here.)

Timeline for d4yw9a1: