![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
![]() | Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) ![]() |
![]() | Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins) |
![]() | Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (42 PDB entries) |
![]() | Domain d4yw9a1: 4yw9 A:1-259 [277415] Other proteins in same PDB: d4yw9a2, d4yw9a3 automated match to d3dt2a1 complexed with 1pe, 1wd, gtp, mn, moh, na |
PDB Entry: 4yw9 (more details), 1.4 Å
SCOPe Domain Sequences for d4yw9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yw9a1 c.109.1.1 (A:1-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]} mppqlhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahm qeegvirklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmsee dfekafnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsv lealgdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsl lgkkcfalriasrlakeeg
Timeline for d4yw9a1: