![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
![]() | Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) ![]() |
![]() | Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins) |
![]() | Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (42 PDB entries) |
![]() | Domain d4ywbc1: 4ywb C:9-259 [277413] Other proteins in same PDB: d4ywba2, d4ywbc2 automated match to d3dt2a1 complexed with 1wd, cl, mn, na, oxd |
PDB Entry: 4ywb (more details), 1.5 Å
SCOPe Domain Sequences for d4ywbc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ywbc1 c.109.1.1 (C:9-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]} ldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahmqeegvirk lkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmseedfekafna rfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvlealgdge fikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsllgkkcfal riasrlakeeg
Timeline for d4ywbc1: