Lineage for d4yw1b1 (4yw1 B:83-273)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781229Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [277387] (9 PDB entries)
  8. 2781241Domain d4yw1b1: 4yw1 B:83-273 [277411]
    Other proteins in same PDB: d4yw1a2, d4yw1a3, d4yw1b2, d4yw1b3
    automated match to d2slia1
    complexed with dan, gol, peg, po4, sia

Details for d4yw1b1

PDB Entry: 4yw1 (more details), 2.25 Å

PDB Description: crystal structure of streptococcus pneumoniae nanc, complex with neu5ac and neu5ac2en following soaking with 3'sl
PDB Compounds: (B:) Neuraminidase C

SCOPe Domain Sequences for d4yw1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yw1b1 b.29.1.0 (B:83-273) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
etpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqq
nsyvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktys
lyangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldee
tvkkmttnavt

SCOPe Domain Coordinates for d4yw1b1:

Click to download the PDB-style file with coordinates for d4yw1b1.
(The format of our PDB-style files is described here.)

Timeline for d4yw1b1: