SCOP 1.57: Domain d1tcmb3: 1tcm B:407-495

Lineage for d1tcmb3 (1tcm B:407-495)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)

4. Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins)

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)

7. Species Bacillus circulans, different strains [TaxId:1397] [51019] (27 PDB entries)

8. Domain d1tcmb3: 1tcm B:407-495 [27741]
   Other proteins in same PDB: d1tcma1, d1tcma2, d1tcma4, d1tcmb1, d1tcmb2, d1tcmb4

Details for d1tcmb3

PDB Entry: 1tcm, 2.2 Å

PDB Description: cyclodextrin glycosyltransferase w616a mutant from bacillus circulans strain 251

SCOP Domain Sequences for d1tcmb3:

Sequence; same for both SEQRES and ATOM records:

>d1tcmb3 b.71.1.1 (B:407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaa

Timeline for d1tcmb3:

• d1tcmb3 first appeared (with stable ids) in SCOP 1.55
  
• d1tcmb3 appears in SCOP 1.59
  
• d1tcmb3 appears in the current release, SCOPe 2.08