Lineage for d4yw3b2 (4yw3 B:274-740)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2807607Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2808129Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2808130Protein automated matches [190692] (20 species)
    not a true protein
  7. 2808310Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [277389] (9 PDB entries)
  8. 2808314Domain d4yw3b2: 4yw3 B:274-740 [277404]
    Other proteins in same PDB: d4yw3a1, d4yw3a3, d4yw3b1, d4yw3b3
    automated match to d2slia2
    complexed with dan, gol, po4, sia

Details for d4yw3b2

PDB Entry: 4yw3 (more details), 2.05 Å

PDB Description: crystal structure of streptococcus pneumoniae nanc, complex with neu5ac and neu5ac2en following soaking with neu5ac2en
PDB Compounds: (B:) Neuraminidase C

SCOPe Domain Sequences for d4yw3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yw3b2 b.68.1.0 (B:274-740) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ghliytandttgsnyfripvlytfsngrvfssidaryggthdflnkiniatsysddngkt
wtkpkltlafddfapvplewprevggrdlqisggatyidsvivekknkqvlmfadvmpag
vsfreatrkdsgykqidgnyylklrkqgdtdynytirengtvyddrtnrptefsvdknfg
ikqngnyltveqysvsfennkkteyrngtkvhmnifykdalfkvvptnyiayissndhge
swsaptllppimglnrnapylgpgrgiiesstgrilipsytgkesafiysddngaswkvk
vvplpsswsaeaqfvelspgviqaymrtnngkiayltskdagttwsapeylkfvsnpsyg
tqlsiinysqlidgkkavilstpnstngrkhgqiwiglinddntidwryhhdvdysnygy
systltelpnheiglmfekfdswsrnelhmknvvpyitfkiedlkkn

SCOPe Domain Coordinates for d4yw3b2:

Click to download the PDB-style file with coordinates for d4yw3b2.
(The format of our PDB-style files is described here.)

Timeline for d4yw3b2: