Lineage for d1tcma3 (1tcm A:407-495)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675781Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 675782Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 675783Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 675921Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 675922Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)
  8. 675950Domain d1tcma3: 1tcm A:407-495 [27740]
    Other proteins in same PDB: d1tcma1, d1tcma2, d1tcma4, d1tcmb1, d1tcmb2, d1tcmb4

Details for d1tcma3

PDB Entry: 1tcm (more details), 2.2 Å

PDB Description: cyclodextrin glycosyltransferase w616a mutant from bacillus circulans strain 251
PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOP Domain Sequences for d1tcma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tcma3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaa

SCOP Domain Coordinates for d1tcma3:

Click to download the PDB-style file with coordinates for d1tcma3.
(The format of our PDB-style files is described here.)

Timeline for d1tcma3: