Lineage for d4ywda1 (4ywd A:9-259)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920699Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2920700Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2920701Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)
  6. 2920702Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species)
  7. 2920712Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (42 PDB entries)
  8. 2920760Domain d4ywda1: 4ywd A:9-259 [277399]
    Other proteins in same PDB: d4ywda2
    automated match to d3dt2a1
    complexed with mn, na, ntm

Details for d4ywda1

PDB Entry: 4ywd (more details), 2.1 Å

PDB Description: structure of rat cytosolic pepck in complex with 2,3-pyridine dicarboxylic acid
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d4ywda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ywda1 c.109.1.1 (A:9-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahmqeegvirk
lkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmseedfekafna
rfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvlealgdge
fikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsllgkkcfal
riasrlakeeg

SCOPe Domain Coordinates for d4ywda1:

Click to download the PDB-style file with coordinates for d4ywda1.
(The format of our PDB-style files is described here.)

Timeline for d4ywda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ywda2