SCOPe 2.08: Domain d4yw2b1: 4yw2 B:83-273

Lineage for d4yw2b1 (4yw2 B:83-273)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [277387] (9 PDB entries)

8. Domain d4yw2b1: 4yw2 B:83-273 [277397]
   Other proteins in same PDB: d4yw2a2, d4yw2a3, d4yw2b2, d4yw2b3
   automated match to d2slia1
   complexed with gol, peg, po4

Details for d4yw2b1

PDB Entry: 4yw2, 2 Å

PDB Description: crystal structure of streptococcus pneumoniae nanc, complex 6'sl

PDB Compounds: (B:) Neuraminidase C

SCOPe Domain Sequences for d4yw2b1:

Sequence; same for both SEQRES and ATOM records:

>d4yw2b1 b.29.1.0 (B:83-273) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
etpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqq
nsyvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktys
lyangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldee
tvkkmttnavt

Timeline for d4yw2b1:

• d4yw2b1 first appeared in SCOPe 2.05
  
• d4yw2b1 appears in SCOPe 2.07