Lineage for d4yw5a2 (4yw5 A:274-740)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2065391Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2065392Protein automated matches [190692] (15 species)
    not a true protein
  7. 2065539Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [277389] (9 PDB entries)
  8. 2065554Domain d4yw5a2: 4yw5 A:274-740 [277392]
    Other proteins in same PDB: d4yw5a1, d4yw5a3, d4yw5b1, d4yw5b3
    automated match to d2slia2
    complexed with edo, g39, gol

Details for d4yw5a2

PDB Entry: 4yw5 (more details), 2.3 Å

PDB Description: crystal structure of streptococcus pneumoniae nanc, complex with oseltamivir carboxylate
PDB Compounds: (A:) Neuraminidase C

SCOPe Domain Sequences for d4yw5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yw5a2 b.68.1.0 (A:274-740) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ghliytandttgsnyfripvlytfsngrvfssidaryggthdflnkiniatsysddngkt
wtkpkltlafddfapvplewprevggrdlqisggatyidsvivekknkqvlmfadvmpag
vsfreatrkdsgykqidgnyylklrkqgdtdynytirengtvyddrtnrptefsvdknfg
ikqngnyltveqysvsfennkkteyrngtkvhmnifykdalfkvvptnyiayissndhge
swsaptllppimglnrnapylgpgrgiiesstgrilipsytgkesafiysddngaswkvk
vvplpsswsaeaqfvelspgviqaymrtnngkiayltskdagttwsapeylkfvsnpsyg
tqlsiinysqlidgkkavilstpnstngrkhgqiwiglinddntidwryhhdvdysnygy
systltelpnheiglmfekfdswsrnelhmknvvpyitfkiedlkkn

SCOPe Domain Coordinates for d4yw5a2:

Click to download the PDB-style file with coordinates for d4yw5a2.
(The format of our PDB-style files is described here.)

Timeline for d4yw5a2: