![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [277387] (9 PDB entries) |
![]() | Domain d4yw5a1: 4yw5 A:83-273 [277391] Other proteins in same PDB: d4yw5a2, d4yw5a3, d4yw5b2, d4yw5b3 automated match to d2slia1 complexed with edo, g39, gol |
PDB Entry: 4yw5 (more details), 2.3 Å
SCOPe Domain Sequences for d4yw5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yw5a1 b.29.1.0 (A:83-273) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} etpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqq nsyvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktys lyangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldee tvkkmttnavt
Timeline for d4yw5a1: