Lineage for d4yw5a1 (4yw5 A:83-273)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781229Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [277387] (9 PDB entries)
  8. 2781244Domain d4yw5a1: 4yw5 A:83-273 [277391]
    Other proteins in same PDB: d4yw5a2, d4yw5a3, d4yw5b2, d4yw5b3
    automated match to d2slia1
    complexed with edo, g39, gol

Details for d4yw5a1

PDB Entry: 4yw5 (more details), 2.3 Å

PDB Description: crystal structure of streptococcus pneumoniae nanc, complex with oseltamivir carboxylate
PDB Compounds: (A:) Neuraminidase C

SCOPe Domain Sequences for d4yw5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yw5a1 b.29.1.0 (A:83-273) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
etpvleknnvtltgggenvtkelkdkftsgdftvvikynqssekglqalfgisnskpgqq
nsyvdvflrdngelgmeardtssnknnlvsrpasvwgkykqeavtntvavvadsvkktys
lyangtkvvekkvdnflnikdikgidyymlggvkragktafgfngtlenikffnsaldee
tvkkmttnavt

SCOPe Domain Coordinates for d4yw5a1:

Click to download the PDB-style file with coordinates for d4yw5a1.
(The format of our PDB-style files is described here.)

Timeline for d4yw5a1: