Lineage for d1cgx_3 (1cgx 407-495)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 233630Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 233631Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 233632Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (18 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 233730Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 233731Species Bacillus circulans, different strains [TaxId:1397] [51019] (29 PDB entries)
  8. 233746Domain d1cgx_3: 1cgx 407-495 [27739]
    Other proteins in same PDB: d1cgx_1, d1cgx_2, d1cgx_4
    complexed with ca, mal; mutant

Details for d1cgx_3

PDB Entry: 1cgx (more details), 2.59 Å

PDB Description: site directed mutations of the active site residue tyrosine 195 of cyclodextrin glyxosyltransferase from bacillus circulans strain 251 affecting activity and product specificity

SCOP Domain Sequences for d1cgx_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgx_3 b.71.1.1 (407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaa

SCOP Domain Coordinates for d1cgx_3:

Click to download the PDB-style file with coordinates for d1cgx_3.
(The format of our PDB-style files is described here.)

Timeline for d1cgx_3: