SCOPe 2.08: Domain d4yu3a_: 4yu3 A:

Lineage for d4yu3a_ (4yu3 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (43 species)
   not a true protein

7. Species Helogale parvula [TaxId:210647] [277372] (2 PDB entries)

8. Domain d4yu3a_: 4yu3 A: [277374]
   automated match to d3lqda_
   complexed with hem, oxy

Details for d4yu3a_

PDB Entry: 4yu3, 2.45 Å

PDB Description: the crystal structure of mongoose (helogale parvula) hemoglobin at ph 8.2

PDB Compounds: (A:) hemoglobin

SCOPe Domain Sequences for d4yu3a_:

Sequence; same for both SEQRES and ATOM records:

>d4yu3a_ a.1.1.2 (A:) automated matches {Helogale parvula [TaxId: 210647]}
vlspadktnikaswekigshggeygaealertflcfpttktyfphfdlshgsaqvkahgk
kvadaltnavghlddlpgalsalsdlhayklrvdpvnfkllshcllvtlashhpaeftpa
vhasldkflssvstvltskyr

Timeline for d4yu3a_:

• d4yu3a_ first appeared in SCOPe 2.05
  
• d4yu3a_ appears in SCOPe 2.07