Lineage for d4yu3b_ (4yu3 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688683Species Helogale parvula [TaxId:210647] [277372] (2 PDB entries)
  8. 2688685Domain d4yu3b_: 4yu3 B: [277373]
    automated match to d3pelb_
    complexed with hem, oxy

Details for d4yu3b_

PDB Entry: 4yu3 (more details), 2.45 Å

PDB Description: the crystal structure of mongoose (helogale parvula) hemoglobin at ph 8.2
PDB Compounds: (B:) hemoglobin

SCOPe Domain Sequences for d4yu3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yu3b_ a.1.1.2 (B:) automated matches {Helogale parvula [TaxId: 210647]}
vhltaeekahvsglwgkvnteevggealgrllvvypwtqrffetfgdlssanaimnnpkv
kahgkkvlssfsdglknldnlkgtfaalselhcdklhvdpenfkllgnvlvcvlahhfgk
eftpqvqaayqkivagvanalahkyh

SCOPe Domain Coordinates for d4yu3b_:

Click to download the PDB-style file with coordinates for d4yu3b_.
(The format of our PDB-style files is described here.)

Timeline for d4yu3b_: