Lineage for d4y5dc_ (4y5d C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2073248Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2073249Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2073250Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2073570Protein automated matches [190191] (2 species)
    not a true protein
  7. 2073663Species Streptomyces avidinii [TaxId:1895] [189343] (50 PDB entries)
  8. 2073695Domain d4y5dc_: 4y5d C: [277369]
    automated match to d3ry1b_
    complexed with dms, mt6, p6g, pe3

Details for d4y5dc_

PDB Entry: 4y5d (more details), 1.2 Å

PDB Description: crystal structure of alis2-streptavidin complex
PDB Compounds: (C:) streptavidin

SCOPe Domain Sequences for d4y5dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y5dc_ b.61.1.1 (C:) automated matches {Streptomyces avidinii [TaxId: 1895]}
agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
ps

SCOPe Domain Coordinates for d4y5dc_:

Click to download the PDB-style file with coordinates for d4y5dc_.
(The format of our PDB-style files is described here.)

Timeline for d4y5dc_: