Lineage for d4y5dd_ (4y5d D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1800830Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1800831Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1800832Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1801148Protein automated matches [190191] (2 species)
    not a true protein
  7. 1801229Species Streptomyces avidinii [TaxId:1895] [189343] (34 PDB entries)
  8. 1801252Domain d4y5dd_: 4y5d D: [277368]
    automated match to d3ry1b_
    complexed with dms, mt6, p6g, pe3

Details for d4y5dd_

PDB Entry: 4y5d (more details), 1.2 Å

PDB Description: crystal structure of alis2-streptavidin complex
PDB Compounds: (D:) streptavidin

SCOPe Domain Sequences for d4y5dd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y5dd_ b.61.1.1 (D:) automated matches {Streptomyces avidinii [TaxId: 1895]}
agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
ps

SCOPe Domain Coordinates for d4y5dd_:

Click to download the PDB-style file with coordinates for d4y5dd_.
(The format of our PDB-style files is described here.)

Timeline for d4y5dd_: